Thermo Fisher Scientific KCNH2 (HERG) Polyclonal Antibody
HERG(KCNH2) 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, ICC/IF, IP에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 Lyophilized 형태. 심장 전위 조절 연구 및 HERG 채널 관련 연구에 적합.
- 카탈로그번호
- APC-062-xxxxx (3개 옵션)
- 판매단위
- pk
카탈로그
3개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific KCNH2 (HERG) Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:400 | |
| Immunocytochemistry (ICC/IF) | Assay-dependent | |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106–1159 of human KV11.1 (HERG), Intracellular, C-terminus |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.6 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Reconstitute with 25 µL, 50 µL, or 0.2 mL double distilled water (DDW), depending on sample size.
- Ships as a lyophilized powder at room temperature.
- Store at -20°C upon arrival.
- Reconstituted solution can be stored at 4°C for up to 1 week; for longer periods, store aliquots at -20°C.
- Avoid multiple freeze/thaw cycles.
- Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
The human ether-a-go-go related gene (HERG) encodes the pore-forming alpha subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants:
- Isoform 1 alpha (full-length)
- Isoform 1 beta (shorter, lacking PAS motif)
Isoform 1 beta deactivates faster than isoform 1 alpha.
Residues within the C-terminal region influence channel expression and gating, including voltage-dependent activation.
HERG is expressed predominantly in the heart, especially in the ventricles.
Mutations in HERG can lead to increased beat-to-beat variability and early after-depolarizations, contributing to long QT syndrome type 2 and short QT syndrome type 1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.