Thermo Fisher Scientific KCNH2 (HERG) Polyclonal Antibody

Thermo Fisher Scientific KCNH2 (HERG) Polyclonal Antibody

상품 한눈에 보기

HERG(KCNH2) 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, ICC/IF, IP에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 Lyophilized 형태. 심장 전위 조절 연구 및 HERG 채널 관련 연구에 적합.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 02. 오후 05:04
소모품
APC-062-200UL
Thermo Fisher Scientific APC-062-200UL KCNH2 (HERG) Polyclonal Antibody 200 ul pk
CAS: -단위: pk
재고문의재고: -
1,121,200
(VAT포함)1,233,320
APC-062-50UL
Thermo Fisher Scientific APC-062-50UL KCNH2 (HERG) Polyclonal Antibody 50 ul pk
CAS: -단위: pk
재고문의재고: -
923,800
(VAT포함)1,016,180
APC-062-25UL
Thermo Fisher Scientific APC-062-25UL KCNH2 (HERG) Polyclonal Antibody 25 ul pk
CAS: -단위: pk
재고문의재고: -
742,000
(VAT포함)816,200
소모품
APC-062-200UL
재고문의재고: -
Thermo Fisher Scientific APC-062-200UL KCNH2 (HERG) Polyclonal Antibody 200 ul pk
CAS: -단위: pk
1,121,200
(VAT포함)1,233,320
APC-062-50UL
재고문의재고: -
Thermo Fisher Scientific APC-062-50UL KCNH2 (HERG) Polyclonal Antibody 50 ul pk
CAS: -단위: pk
923,800
(VAT포함)1,016,180
APC-062-25UL
재고문의재고: -
Thermo Fisher Scientific APC-062-25UL KCNH2 (HERG) Polyclonal Antibody 25 ul pk
CAS: -단위: pk
742,000
(VAT포함)816,200

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Applications and Tested Dilution

Application Tested Dilution Notes
Western Blot (WB) 1:400
Immunocytochemistry (ICC/IF) Assay-dependent
Immunoprecipitation (IP) Assay-dependent

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106–1159 of human KV11.1 (HERG), Intracellular, C-terminus
Conjugate Unconjugated
Form Lyophilized
Concentration 0.6 mg/mL
Purification Antigen affinity chromatography
Storage buffer PBS, pH 7.4, with 1% BSA
Contains 0.05% sodium azide
Storage conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping conditions Ambient (domestic); Wet ice (international)

Product Specific Information

  • Reconstitution: Reconstitute with 25 µL, 50 µL, or 0.2 mL double distilled water (DDW), depending on sample size.
  • Ships as a lyophilized powder at room temperature.
  • Store at -20°C upon arrival.
  • Reconstituted solution can be stored at 4°C for up to 1 week; for longer periods, store aliquots at -20°C.
  • Avoid multiple freeze/thaw cycles.
  • Centrifuge all antibody preparations before use (10,000 × g, 5 min).

Target Information

The human ether-a-go-go related gene (HERG) encodes the pore-forming alpha subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants:

  • Isoform 1 alpha (full-length)
  • Isoform 1 beta (shorter, lacking PAS motif)

Isoform 1 beta deactivates faster than isoform 1 alpha.
Residues within the C-terminal region influence channel expression and gating, including voltage-dependent activation.
HERG is expressed predominantly in the heart, especially in the ventricles.
Mutations in HERG can lead to increased beat-to-beat variability and early after-depolarizations, contributing to long QT syndrome type 2 and short QT syndrome type 1.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0