
Thermo Fisher Scientific KCNH2 (HERG) Polyclonal Antibody
HERG(KCNH2) 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, ICC/IF, IP에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 Lyophilized 형태. 심장 전위 조절 연구 및 HERG 채널 관련 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:400 | |
| Immunocytochemistry (ICC/IF) | Assay-dependent | |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106–1159 of human KV11.1 (HERG), Intracellular, C-terminus |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.6 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Reconstitute with 25 µL, 50 µL, or 0.2 mL double distilled water (DDW), depending on sample size.
- Ships as a lyophilized powder at room temperature.
- Store at -20°C upon arrival.
- Reconstituted solution can be stored at 4°C for up to 1 week; for longer periods, store aliquots at -20°C.
- Avoid multiple freeze/thaw cycles.
- Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
The human ether-a-go-go related gene (HERG) encodes the pore-forming alpha subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants:
- Isoform 1 alpha (full-length)
- Isoform 1 beta (shorter, lacking PAS motif)
Isoform 1 beta deactivates faster than isoform 1 alpha.
Residues within the C-terminal region influence channel expression and gating, including voltage-dependent activation.
HERG is expressed predominantly in the heart, especially in the ventricles.
Mutations in HERG can lead to increased beat-to-beat variability and early after-depolarizations, contributing to long QT syndrome type 2 and short QT syndrome type 1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific KCNN4 (KCa3.1, SK4) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.7 (KCNA7) Polyclonal Antibody
923,800원

Thermo Fisher Scientific
Thermo Fisher Scientific KCNH2 (HERG) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KCNJ15 (Kir4.2) Polyclonal Antibody
923,800원

Thermo Fisher Scientific
Thermo Fisher Scientific slo beta 4 (KCNMB4) Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|