
Atlas Antibodies Anti-LANCL2 Antibody
상품 한눈에 보기
Human LANCL2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. GPR69B, TASP로도 알려진 LANCL2 단백질 검출에 사용되며, PrEST 항원으로 친화 정제되었습니다. 인체 유래 시료 분석 연구에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LANCL2 Antibody
LanC lantibiotic synthetase component C-like 2 (bacterial)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human LANCL2.
Alternative Gene Names
GPR69B, TASP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LanC lantibiotic synthetase component C-like 2 (bacterial) |
| Target Gene | LANCL2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000006810 (93%), Mouse ENSMUSG00000062190 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LANCL3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LANCL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LANCL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMTOR5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMTOR4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.