
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LANCL2 Antibody
상품 한눈에 보기
Human LANCL2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. GPR69B, TASP로도 알려진 LANCL2 단백질 검출에 사용되며, PrEST 항원으로 친화 정제되었습니다. 인체 유래 시료 분석 연구에 활용 가능합니다.
- 카탈로그번호
- HPA029535-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029535-100 Anti-LANCL2 Antibody, LanC lantibiotic synthetase component C-like 2 (bacterial) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029535-25 Anti-LANCL2 Antibody, LanC lantibiotic synthetase component C-like 2 (bacterial) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LANCL2 Antibody
Anti-LANCL2 Antibody
LanC lantibiotic synthetase component C-like 2 (bacterial)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human LANCL2.
Alternative Gene Names
GPR69B, TASP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LanC lantibiotic synthetase component C-like 2 (bacterial) |
| Target Gene | LANCL2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000006810 (93%), Mouse ENSMUSG00000062190 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



