Atlas Antibodies Anti-LAMTOR4 Antibody

상품 한눈에 보기

Human LAMTOR4 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 고품질 항체입니다.

카탈로그번호: HPA020998-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA020998-100 Anti-LAMTOR4 Antibody, late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA020998-25 Anti-LAMTOR4 Antibody, late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LAMTOR4 Antibody

Anti-LAMTOR4 Antibody

Target: late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation: protein expression compared to RNA-seq data in high and low expression tissues)
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human LAMTOR4

Alternative Gene Names

C7orf59

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
Target Gene	LAMTOR4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
Verified Species Reactivity	Human
Interspecies Identity	Rat (97%), Mouse (96%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand