CacheBy
Atlas Antibodies Anti-LANCL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LANCL2 Antibody

상품 한눈에 보기

Human LANCL2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가집니다. 40% 글리세롤/PBS 완충액에 보존제를 포함합니다.

카탈로그번호
HPA019711-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019711-100 Anti-LANCL2 Antibody, LanC lantibiotic synthetase component C-like 2 (bacterial) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019711-25 Anti-LANCL2 Antibody, LanC lantibiotic synthetase component C-like 2 (bacterial) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LANCL2 Antibody

Anti-LANCL2 Antibody

LanC lantibiotic synthetase component C-like 2 (bacterial)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LANCL2.

Alternative Gene Names

GPR69B, TASP

Open Datasheet

Target Information

항목 내용
Target Protein LanC lantibiotic synthetase component C-like 2 (bacterial)
Target Gene LANCL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000062190 (93%), Rat ENSRNOG00000006810 (93%)

Antigen Sequence

ALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.