Thermo Fisher Scientific HKDC1 Polyclonal Antibody
Thermo Fisher Scientific의 HKDC1 Polyclonal Antibody는 인간 HKDC1 단백질을 인식하는 토끼 유래 IgG 항체로, Western blot에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, -20°C에서 보관합니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific HKDC1 Polyclonal Antibody
Thermo Fisher Scientific HKDC1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1 (102–136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746481 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The epidermal growth factor receptor (HKDC1; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It belongs to the ErbB family of receptors, which includes HKDC1 (ErbB-1), HER2/c-neu (ErbB-2), Her3 (ErbB-3), and Her4 (ErbB-4). HKDC1 is activated by binding to specific ligands such as epidermal growth factor and transforming growth factor alpha (TGFα). These molecules are involved in cell signaling processes including proliferation, differentiation, motility, survival, and tissue development. Overexpression or overactivity of HKDC1 has been associated with various cancers, such as lung cancer and glioblastoma multiforme, where a specific mutation called HKDC1vIII is often observed.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.