Thermo Fisher Scientific HKDC1 Polyclonal Antibody
Thermo Fisher Scientific의 HKDC1 Polyclonal Antibody는 인간 HKDC1 단백질을 인식하는 토끼 유래 IgG 항체로, Western blot에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, -20°C에서 보관합니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific HKDC1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1 (102–136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746481 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The epidermal growth factor receptor (HKDC1; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It belongs to the ErbB family of receptors, which includes HKDC1 (ErbB-1), HER2/c-neu (ErbB-2), Her3 (ErbB-3), and Her4 (ErbB-4). HKDC1 is activated by binding to specific ligands such as epidermal growth factor and transforming growth factor alpha (TGFα). These molecules are involved in cell signaling processes including proliferation, differentiation, motility, survival, and tissue development. Overexpression or overactivity of HKDC1 has been associated with various cancers, such as lung cancer and glioblastoma multiforme, where a specific mutation called HKDC1vIII is often observed.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific HLA-A Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HLA-C Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HKDC1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HINT1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HGF Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|