원본
Thermo Fisher Scientific ASPH Polyclonal Antibody
상품 한눈에 보기
ASPH 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 고품질 항체로 연구용에 적합.
- 카탈로그번호
- PA578827
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 06:59
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578827 ASPH Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific ASPH Polyclonal Antibody
Thermo Fisher Scientific ASPH Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | 1 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ASPH (726–758aa, sequence: EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745943 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ASPH는 칼슘 항상성 유지에 중요한 역할을 하는 것으로 알려져 있습니다. 이 유전자는 대체 스플라이싱을 통해 5가지 전사체 변이체를 생성하며, 각각 단백질 번역, 촉매 도메인 코딩, 조직 발현에 차이를 보입니다. 이러한 변이체들은 소포체 및 근소포체 내 칼슘 저장 및 방출 과정, 그리고 다양한 단백질의 EGF 유사 도메인 내 아스파르트산 및 아스파라긴의 하이드록실화에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78827_ASPH_Q12797-1_Rabbit.svg, PA5-78827_ASPH_Q12797-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific ATF1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ASL Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific beta Arrestin 1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ASXL1 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.