Thermo Fisher Scientific ASPH Polyclonal Antibody
ASPH 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 고품질 항체로 연구용에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific ASPH Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | 1 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ASPH (726–758aa, sequence: EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745943 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ASPH는 칼슘 항상성 유지에 중요한 역할을 하는 것으로 알려져 있습니다. 이 유전자는 대체 스플라이싱을 통해 5가지 전사체 변이체를 생성하며, 각각 단백질 번역, 촉매 도메인 코딩, 조직 발현에 차이를 보입니다. 이러한 변이체들은 소포체 및 근소포체 내 칼슘 저장 및 방출 과정, 그리고 다양한 단백질의 EGF 유사 도메인 내 아스파르트산 및 아스파라긴의 하이드록실화에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78827_ASPH_Q12797-1_Rabbit.svg, PA5-78827_ASPH_Q12797-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ATF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ASL Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ASPH Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific beta Arrestin 1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ASXL1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|