CacheBy
Thermo Fisher Scientific ASXL1 Polyclonal Antibody
원본

Thermo Fisher Scientific ASXL1 Polyclonal Antibody

상품 한눈에 보기

ASXL1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 Flow cytometry에 적합합니다. Human, Mouse, Rat 시료에 반응하며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 01:42
Thermo Fisher Scientific PA578828 ASXL1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific ASXL1 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Flow Cytometry (Flow)

  • Tested Dilution: 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains No preservative
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2745944

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG). Acts as a coactivator of RARA and RXRA through association with NCOA1. Functions as a corepressor through recruitment of KDM1A and CBX5 to target genes in a cell-type specific manner, involving differential recruitment of methylated histone H3 to promoters. Acts as a corepressor for PPARG and suppresses its adipocyte differentiation-inducing activity. Non-catalytic component of the PR-DUB complex, which mediates deubiquitination of histone H2A monoubiquitinated at Lys-119 (H2AK119ub1).


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.