CacheBy
Thermo Fisher Scientific SMN1/SMN2 Monoclonal Antibody (2B10)
원본

Thermo Fisher Scientific SMN1/SMN2 Monoclonal Antibody (2B10)

상품 한눈에 보기

SMN1/SMN2 단백질을 인식하는 mouse monoclonal antibody(2B10)로, Western blot, IHC, ICC 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 상태로 제공되어 안정적 보관이 가능합니다. 연구용 전용 시약입니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오전 09:16
Thermo Fisher Scientific MA527878 SMN1/SMN2 Monoclonal Antibody (2B10) 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific SMN1/SMN2 Monoclonal Antibody (2B10)

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (IHC) 1 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Clone 2B10
Immunogen Synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22–52 aa: RRGTGQSDDSDIWDDTALIKAYDKAVASFKH)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2744934

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The SMN1 gene is part of a 500 kb inverted duplication on chromosome 5q13. This region includes multiple genes and repetitive elements, making it prone to rearrangements and deletions. The telomeric and centromeric copies of this gene encode the same survival motor neuron protein, which plays a catalytic role in the assembly of small nuclear ribonucleoproteins (snRNPs), essential components of the spliceosome. Mutations in the SMN1 gene are associated with spinal muscular atrophy types 1 and 2.


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.