
Thermo Fisher Scientific SMN1/SMN2 Monoclonal Antibody (2B10)
SMN1/SMN2 단백질을 인식하는 mouse monoclonal antibody(2B10)로, Western blot, IHC, ICC 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 상태로 제공되어 안정적 보관이 가능합니다. 연구용 전용 시약입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (IHC) | 1 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 2B10 |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22–52 aa: RRGTGQSDDSDIWDDTALIKAYDKAVASFKH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2744934 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The SMN1 gene is part of a 500 kb inverted duplication on chromosome 5q13. This region includes multiple genes and repetitive elements, making it prone to rearrangements and deletions. The telomeric and centromeric copies of this gene encode the same survival motor neuron protein, which plays a catalytic role in the assembly of small nuclear ribonucleoproteins (snRNPs), essential components of the spliceosome. Mutations in the SMN1 gene are associated with spinal muscular atrophy types 1 and 2.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific H4K5ac Recombinant Rabbit Monoclonal Antibody (RM199)
682,300원

Thermo Fisher Scientific
Thermo Fisher Scientific CRM1 Monoclonal Antibody (5G3)
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SMN1/SMN2 Monoclonal Antibody (2B10)
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PON1 Monoclonal Antibody (9D3)
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PI3 Monoclonal Antibody (C7)
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|