CacheBy
Thermo Fisher Scientific HMGB1 Polyclonal Antibody
원본

Thermo Fisher Scientific HMGB1 Polyclonal Antibody

상품 한눈에 보기

HMGB1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot, IHC, ICC, Flow Cytometry에 적합. 고순도 항원 친화 크로마토그래피 정제. -20°C 보관, 연구용 전용.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 01:01
Thermo Fisher Scientific PA579373 HMGB1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific HMGB1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 5 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to the C-terminus of human HMGB1 (124–154 aa, DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Wet ice
RRID AB_2746489

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

HMGB1 (High-mobility group box-1) is a nuclear non-histone DNA-binding protein. It can be released from damaged or necrotic cells, acting as a proinflammatory cytokine.
Mouse HMGB1 is a 215 amino acid single-chain polypeptide with three domains:

  • Two positively charged DNA-binding domains (HMG box A: aa 9–79, box B: aa 89–162)
  • A negatively charged 30 aa C-terminal acidic tail region
    Residues 28–44 and 180–185 contain nuclear localization signals (NLS).
    The B box mediates cytokine activity, while the A box is associated with transcription factor binding. HMGB1 promotes monocyte migration, cytokine secretion, and mediates T cell–dendritic cell interactions.
    It signals through receptors such as RAGE, TLR2, and TLR4. HMGB1 is highly conserved and ubiquitously expressed in nuclei and cytoplasm of most cell types, acting as a key mediator of sterile and infection-associated inflammation.
    Elevated HMGB1 levels are observed in tissue injury, infection, sepsis, arthritis, and ischemia-reperfusion injury.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.