
Thermo Fisher Scientific HMGB1 Polyclonal Antibody
HMGB1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot, IHC, ICC, Flow Cytometry에 적합. 고순도 항원 친화 크로마토그래피 정제. -20°C 보관, 연구용 전용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 5 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human HMGB1 (124–154 aa, DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746489 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HMGB1 (High-mobility group box-1) is a nuclear non-histone DNA-binding protein. It can be released from damaged or necrotic cells, acting as a proinflammatory cytokine.
Mouse HMGB1 is a 215 amino acid single-chain polypeptide with three domains:
- Two positively charged DNA-binding domains (HMG box A: aa 9–79, box B: aa 89–162)
- A negatively charged 30 aa C-terminal acidic tail region
Residues 28–44 and 180–185 contain nuclear localization signals (NLS).
The B box mediates cytokine activity, while the A box is associated with transcription factor binding. HMGB1 promotes monocyte migration, cytokine secretion, and mediates T cell–dendritic cell interactions.
It signals through receptors such as RAGE, TLR2, and TLR4. HMGB1 is highly conserved and ubiquitously expressed in nuclei and cytoplasm of most cell types, acting as a key mediator of sterile and infection-associated inflammation.
Elevated HMGB1 levels are observed in tissue injury, infection, sepsis, arthritis, and ischemia-reperfusion injury.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific RHAMM Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific HMBS Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific HMGB1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific HMG4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific HLA-DQB1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|