
원본
Thermo Fisher Scientific HMGB1 Polyclonal Antibody
상품 한눈에 보기
HMGB1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot, IHC, ICC, Flow Cytometry에 적합. 고순도 항원 친화 크로마토그래피 정제. -20°C 보관, 연구용 전용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 01:01
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579373 HMGB1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific HMGB1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 5 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human HMGB1 (124–154 aa, DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746489 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HMGB1 (High-mobility group box-1) is a nuclear non-histone DNA-binding protein. It can be released from damaged or necrotic cells, acting as a proinflammatory cytokine.
Mouse HMGB1 is a 215 amino acid single-chain polypeptide with three domains:
- Two positively charged DNA-binding domains (HMG box A: aa 9–79, box B: aa 89–162)
- A negatively charged 30 aa C-terminal acidic tail region
Residues 28–44 and 180–185 contain nuclear localization signals (NLS).
The B box mediates cytokine activity, while the A box is associated with transcription factor binding. HMGB1 promotes monocyte migration, cytokine secretion, and mediates T cell–dendritic cell interactions.
It signals through receptors such as RAGE, TLR2, and TLR4. HMGB1 is highly conserved and ubiquitously expressed in nuclei and cytoplasm of most cell types, acting as a key mediator of sterile and infection-associated inflammation.
Elevated HMGB1 levels are observed in tissue injury, infection, sepsis, arthritis, and ischemia-reperfusion injury.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
