Thermo Fisher Scientific HLA-DQB1 Polyclonal Antibody
Thermo Fisher Scientific의 HLA-DQB1 Polyclonal Antibody는 인간 HLA-DQB1 단백질을 인식하는 토끼 유래 IgG 항체입니다. Western Blot 및 Immunocytochemistry에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용됩니다.
- 카탈로그번호
- PA579370
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific HLA-DQB1 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human HLA-DQB1 (DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746486 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.
Class II molecules are expressed in antigen-presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26–28 kDa and encoded by six exons:
- Exon 1: leader peptide
- Exons 2 and 3: extracellular domains
- Exon 4: transmembrane domain
- Exon 5: cytoplasmic tail
Within the DR molecule, the beta chain contains all polymorphisms specifying peptide binding specificities. Hundreds of DRB1 alleles have been described, and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation.
DRB1 is expressed at levels five times higher than its paralogs DRB3, DRB4, and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4, and DRB5. There are four related pseudogenes: DRB2, DRB6, DRB7, DRB8, and DRB9.
HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem mass spectrometry.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.