
Atlas Antibodies Anti-ISYNA1 Antibody
Human ISYNA1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터 기반 검증 완료. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ISYNA1 Antibody
Target Protein: inositol-3-phosphate synthase 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation: RNA-seq 데이터 기반 단백질 발현 비교)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human ISYNA1.
Alternative Gene Names
Ino1, INOS, IPS
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDLA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000019741 | 95% |
| Mouse | ENSMUSG00000019139 | 93% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 응용별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ITFG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITCH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ISYNA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ISYNA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITCH Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|