CacheBy
Atlas Antibodies Anti-ISYNA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ISYNA1 Antibody

상품 한눈에 보기

Human ISYNA1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용 가능. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007931-100 Anti-ISYNA1 Antibody, inositol-3-phosphate synthase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007931-25 Anti-ISYNA1 Antibody, inositol-3-phosphate synthase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ISYNA1 Antibody

Anti-ISYNA1 Antibody

Target Protein: inositol-3-phosphate synthase 1
Supplier: Atlas Antibodies

  • IHC (Orthogonal validation)
  • WB
  • ICC

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human ISYNA1

Alternative Gene Names

Ino1, INOS, IPS

Open Datasheet

Target Information

항목 내용
Target Protein inositol-3-phosphate synthase 1
Target Gene ISYNA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat (95%), Mouse (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence:
SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDLA

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.