CacheBy
Atlas Antibodies Anti-ITCH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITCH Antibody

상품 한눈에 보기

Human ITCH 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제되었습니다. IHC 등 다양한 응용에 적합하며, 고순도와 높은 특이성을 제공합니다. 40% glycerol 기반의 안정한 buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049032-100 Anti-ITCH Antibody, itchy E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049032-25 Anti-ITCH Antibody, itchy E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITCH Antibody

Anti-ITCH Antibody

Target Information

  • Target Protein: itchy E3 ubiquitin protein ligase
  • Target Gene: ITCH
  • Alternative Gene Names: AIP4

Product Description

Polyclonal Antibody against Human ITCH

면역조직화학(IHC) 등 다양한 연구 응용에 사용 가능

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000059043 (79%)
  • Mouse ENSMUSG00000027598 (79%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.