
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-INTS8 Antibody
상품 한눈에 보기
Human INTS8 단백질을 인식하는 rabbit polyclonal 항체로 IHC, WB, ICC에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. 다양한 종에서 높은 항원 서열 동일성을 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057299-100 Anti-INTS8 Antibody, integrator complex subunit 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057299-25 Anti-INTS8 Antibody, integrator complex subunit 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-INTS8 Antibody
Anti-INTS8 Antibody
Target: Integrator complex subunit 8
Clonality: Polyclonal
Host: Rabbit
Application: IHC, WB, ICC
Product Description
Polyclonal antibody against human INTS8 protein.
Alternative Gene Names
C8orf52, FLJ20530, INT8, MGC131633
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Integrator complex subunit 8 |
| Target Gene | INTS8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAK |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000040738 (100%)
- Rat ENSRNOG00000008124 (100%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



