
Atlas Antibodies Anti-INTS9 Antibody
상품 한눈에 보기
Human INTS9 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며 WB 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. Human에 검증된 반응성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-INTS9 Antibody
Target Information
- Target Protein: Integrator complex subunit 9
- Target Gene: INTS9
- Alternative Gene Names: CPSF2L, FLJ10871, RC-74
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human INTS9.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
FAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000013459 | 97% |
| Mouse | ENSMUSG00000021975 | 97% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-INTU Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS6L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.