CacheBy
Atlas Antibodies Anti-INTU Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-INTU Antibody

상품 한눈에 보기

Human INTU 단백질을 인식하는 토끼 폴리클로날 항체로, inturned planar cell polarity protein 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. Human에 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061467-100 Anti-INTU Antibody, inturned planar cell polarity protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061467-25 Anti-INTU Antibody, inturned planar cell polarity protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-INTU Antibody

Anti-INTU Antibody

Target Protein: inturned planar cell polarity protein
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human INTU protein.


Alternative Gene Names

KIAA1284, PDZD6, PDZK6

Open Datasheet


Target Information

항목 내용
Target Protein inturned planar cell polarity protein
Target Gene INTU
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDMLENVTGTQVTSSSLL

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000060798 77%
Rat ENSRNOG00000010556 55%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.