
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-INTS5 Antibody
상품 한눈에 보기
Human INTS5 단백질을 인식하는 토끼 폴리클로날 항체로, integrator complex subunit 5 검출에 적합합니다. Affinity purification으로 높은 특이도와 재현성을 제공합니다. ICC 등 다양한 응용에 추천됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056915-100 Anti-INTS5 Antibody, integrator complex subunit 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056915-25 Anti-INTS5 Antibody, integrator complex subunit 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-INTS5 Antibody
Anti-INTS5 Antibody
Target: integrator complex subunit 5
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human INTS5.
Alternative Gene Names
INT5, KIAA1698
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | integrator complex subunit 5 |
| Target Gene | INTS5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TNRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKFVQSRNQQEVIYNTQSLLSLLVHCCSAPGGTECGECWGAPILSPEAAKAVAVTLVESVCPDAA |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000071652 | 88% |
| Rat | ENSRNOG00000026005 | 87% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



