원본
Thermo Fisher Scientific UHRF1BP1 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 UHRF1BP1 Polyclonal Antibody는 인간 UHRF1BP1 단백질을 인식하는 토끼 유래 항체로, IHC(P) 및 ICC/IF에 사용 가능합니다. 항원 친화 크로마토그래피로 정제되었으며, PBS와 글리세롤 버퍼에 보관됩니다. 연구용으로만 사용 가능합니다.
- 카탈로그번호
- PA556928
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 11:54
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA556928 UHRF1BP1 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
773,300원VAT 포함 850,630원
Thermo Fisher Scientific · Thermo Fisher Scientific UHRF1BP1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:200–1:500 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human UHRF1BP1. Recombinant protein control fragment (Product #RP-94621). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2649254 |
Product Specific Information
Immunogen sequence:
RETAVNGQGELIPLKNIEGELSSAIHMTKDATKEALHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLSLP
Sequence identity:
- Mouse: 86%
- Rat: 89%
Target Information
UHRF1BP1 (UHRF1 binding protein 1)은 1,440 아미노산으로 구성된 단백질로, UHRF1과 상호작용하며 세포 성장의 음성 조절자로 작용할 수 있습니다.
UHRF1BP1 단백질은 전신성 홍반루푸스(systemic lupus erythematosus)의 위험 인자로 보고되었으며, 인간 염색체 6p21.31에 위치합니다.
이 유전자는 침팬지, 개, 소, 생쥐, 쥐, 닭, 제브라피시, C. elegans 등에서 보존되어 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific NAV3 Polyclonal Antibody773,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Kazrin Polyclonal Antibody773,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TATDN3 Polyclonal Antibody773,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific GPATCH3 Polyclonal Antibody773,300원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.