Thermo Fisher Scientific UHRF1BP1 Polyclonal Antibody
Thermo Fisher Scientific의 UHRF1BP1 Polyclonal Antibody는 인간 UHRF1BP1 단백질을 인식하는 토끼 유래 항체로, IHC(P) 및 ICC/IF에 사용 가능합니다. 항원 친화 크로마토그래피로 정제되었으며, PBS와 글리세롤 버퍼에 보관됩니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:200–1:500 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human UHRF1BP1. Recombinant protein control fragment (Product #RP-94621). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2649254 |
Product Specific Information
Immunogen sequence:
RETAVNGQGELIPLKNIEGELSSAIHMTKDATKEALHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLSLP
Sequence identity:
- Mouse: 86%
- Rat: 89%
Target Information
UHRF1BP1 (UHRF1 binding protein 1)은 1,440 아미노산으로 구성된 단백질로, UHRF1과 상호작용하며 세포 성장의 음성 조절자로 작용할 수 있습니다.
UHRF1BP1 단백질은 전신성 홍반루푸스(systemic lupus erythematosus)의 위험 인자로 보고되었으며, 인간 염색체 6p21.31에 위치합니다.
이 유전자는 침팬지, 개, 소, 생쥐, 쥐, 닭, 제브라피시, C. elegans 등에서 보존되어 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific NAV3 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific Kazrin Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific UHRF1BP1 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific TATDN3 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific GPATCH3 Polyclonal Antibody
773,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|