
Atlas Antibodies Anti-ZNF488 Antibody
상품 한눈에 보기
Human ZNF488를 인식하는 폴리클로날 래빗 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. PrEST 항원으로 친화정제되었으며, 40% 글리세롤 PBS 버퍼에 보존됨. 인간 반응성이 검증된 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF488 Antibody
Target Protein: zinc finger protein 488
Product Type: Polyclonal Antibody against Human ZNF488
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Alternative Gene Names
- FLJ32104
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
WRLSEPELGRGCKPVLLEKTNRLGPEAAVGRAGRDVGSAELALLVAPGKPRPGKPLPPKTRGEQRQSAFTELPRMKDRQVD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000057542 | 39% |
| Mouse | ENSMUSG00000044519 | 33% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF490 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF497 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF488 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF487 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF469 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.