
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF488 Antibody
상품 한눈에 보기
Human ZNF488를 인식하는 폴리클로날 래빗 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. PrEST 항원으로 친화정제되었으며, 40% 글리세롤 PBS 버퍼에 보존됨. 인간 반응성이 검증된 고품질 연구용 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035958-100 Anti-ZNF488 Antibody, zinc finger protein 488 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035958-25 Anti-ZNF488 Antibody, zinc finger protein 488 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF488 Antibody
Anti-ZNF488 Antibody
Target Protein: zinc finger protein 488
Product Type: Polyclonal Antibody against Human ZNF488
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Alternative Gene Names
- FLJ32104
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
WRLSEPELGRGCKPVLLEKTNRLGPEAAVGRAGRDVGSAELALLVAPGKPRPGKPLPPKTRGEQRQSAFTELPRMKDRQVD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000057542 | 39% |
| Mouse | ENSMUSG00000044519 | 33% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



