Atlas Antibodies Anti-ZNF487 Antibody

상품 한눈에 보기

인간 ZNF487(zinc finger protein 487)을 인식하는 폴리클로날 항체로, 래빗 호스트에서 생산됨. Affinity 정제된 IgG 형태이며, ICC 등 다양한 응용에 적합. 인체 반응성 검증 완료, 안정한 PBS/glycerol buffer로 보존됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037820-100 Anti-ZNF487 Antibody, zinc finger protein 487 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037820-25 Anti-ZNF487 Antibody, zinc finger protein 487 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ZNF487 Antibody

Anti-ZNF487 Antibody

Target Information

Target Protein: Zinc finger protein 487
Target Gene: ZNF487
Alternative Gene Names: KRBO1, ZNF487P

Product Description

Polyclonal antibody against human ZNF487.

Recommended Applications

Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EVVCKLEHGQVLWILEEESPSQSHLDCCIDDDLMEKRQENQDQHLQKVDFVNNKTLTMDRNGVLGKTFSLDTNPILSRKIRGNCDSSG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000031478 (34%)
Mouse ENSMUSG00000056824 (34%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage & Handling Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.