CacheBy
Atlas Antibodies Anti-ZNF497 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF497 Antibody

상품 한눈에 보기

Human ZNF497 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며, 40% glycerol/PBS buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047872-100 Anti-ZNF497 Antibody, zinc finger protein 497 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047872-25 Anti-ZNF497 Antibody, zinc finger protein 497 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF497 Antibody

Anti-ZNF497 Antibody

Target Protein: Zinc finger protein 497
Target Gene: ZNF497

  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human ZNF497.

Alternative Gene Names

  • FLJ44773

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRAL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000060662 33%
Mouse ENSMUSG00000063663 30%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.