CacheBy
Thermo Fisher Scientific SAP102 Polyclonal Antibody
원본

Thermo Fisher Scientific SAP102 Polyclonal Antibody

상품 한눈에 보기

SAP102 단백질을 인식하는 Rabbit Polyclonal Antibody로, 인간 및 랫트 시료에 반응합니다. Western blot에 최적화되어 있으며, 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 재구성 후 안정적인 단기 보관이 가능합니다.

카탈로그번호
APZ-003-xxxxx (2개 옵션)
판매단위
pk
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 03:32
Thermo Fisher Scientific APZ-003-200UL SAP102 Polyclonal Antibody 200 ul pk판매 단위 pk ·
재고 확인 필요
1,121,200원VAT 포함 1,233,320원
Thermo Fisher Scientific APZ-003-50UL SAP102 Polyclonal Antibody 50 ul pk판매 단위 pk ·
재고 확인 필요
923,800원VAT 포함 1,016,180원

Thermo Fisher Scientific · Thermo Fisher Scientific SAP102 Polyclonal Antibody

Thermo Fisher Scientific SAP102 Polyclonal Antibody

Applications

  • Western Blot (WB)
    Tested Dilution: 1:400

Product Specifications

항목 내용
Species Reactivity Human, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93–124 of human SAP102 (N-terminal domain)
Conjugate Unconjugated
Form Lyophilized
Concentration 0.8 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.4, with 1% BSA
Contains 0.05% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)

Product Specific Information

  • Reconstitution: Add 50 µL or 0.2 mL double distilled water (DDW), depending on sample size.
  • Ships as a lyophilized powder at room temperature.
  • Store upon arrival at -20°C.
  • Reconstituted solution can be stored at 4°C for up to 1 week.
  • For longer storage, aliquot and keep at -20°C.
  • Avoid repeated freeze/thaw cycles.
  • Centrifuge antibody preparations before use (10,000 × g, 5 min).

Target Information

Synapse-Associated Protein 102 (SAP102) is a plasma membrane-associated protein found in synaptic junctions. It contains three PDZ domains, an SH3 domain, and a Guanylate Kinase (GuK) domain.
PDZ-domain interactions are thought to contribute to receptor and channel clustering, influencing neuronal plasticity.
SAP102 interacts with NMDA receptors and shaker-type potassium channels at synaptic membranes.
Other neuronal proteins with similar motifs (such as β1 adrenergic receptors, serotonin receptors, sodium channel subunits, and potassium channel subunits) may also bind to SAP102 via PDZ domains.
Neuronal nitric oxide synthase (nNOS) can associate with SAP102 through PDZ-PDZ interactions.

For Research Use Only. Not for use in diagnostic procedures or resale without authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.