
Thermo Fisher Scientific SAP102 Polyclonal Antibody
SAP102 단백질을 인식하는 Rabbit Polyclonal Antibody로, 인간 및 랫트 시료에 반응합니다. Western blot에 최적화되어 있으며, 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 재구성 후 안정적인 단기 보관이 가능합니다.
- 카탈로그번호
- APZ-003-xxxxx (2개 옵션)
- 판매단위
- pk
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SAP102 Polyclonal Antibody
Thermo Fisher Scientific SAP102 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1:400
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93–124 of human SAP102 (N-terminal domain) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Add 50 µL or 0.2 mL double distilled water (DDW), depending on sample size.
- Ships as a lyophilized powder at room temperature.
- Store upon arrival at -20°C.
- Reconstituted solution can be stored at 4°C for up to 1 week.
- For longer storage, aliquot and keep at -20°C.
- Avoid repeated freeze/thaw cycles.
- Centrifuge antibody preparations before use (10,000 × g, 5 min).
Target Information
Synapse-Associated Protein 102 (SAP102) is a plasma membrane-associated protein found in synaptic junctions. It contains three PDZ domains, an SH3 domain, and a Guanylate Kinase (GuK) domain.
PDZ-domain interactions are thought to contribute to receptor and channel clustering, influencing neuronal plasticity.
SAP102 interacts with NMDA receptors and shaker-type potassium channels at synaptic membranes.
Other neuronal proteins with similar motifs (such as β1 adrenergic receptors, serotonin receptors, sodium channel subunits, and potassium channel subunits) may also bind to SAP102 via PDZ domains.
Neuronal nitric oxide synthase (nNOS) can associate with SAP102 through PDZ-PDZ interactions.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.

