
Thermo Fisher Scientific SAP102 Polyclonal Antibody
SAP102 단백질을 인식하는 Rabbit Polyclonal Antibody로, 인간 및 랫트 시료에 반응합니다. Western blot에 최적화되어 있으며, 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 재구성 후 안정적인 단기 보관이 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific SAP102 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1:400
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93–124 of human SAP102 (N-terminal domain) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Add 50 µL or 0.2 mL double distilled water (DDW), depending on sample size.
- Ships as a lyophilized powder at room temperature.
- Store upon arrival at -20°C.
- Reconstituted solution can be stored at 4°C for up to 1 week.
- For longer storage, aliquot and keep at -20°C.
- Avoid repeated freeze/thaw cycles.
- Centrifuge antibody preparations before use (10,000 × g, 5 min).
Target Information
Synapse-Associated Protein 102 (SAP102) is a plasma membrane-associated protein found in synaptic junctions. It contains three PDZ domains, an SH3 domain, and a Guanylate Kinase (GuK) domain.
PDZ-domain interactions are thought to contribute to receptor and channel clustering, influencing neuronal plasticity.
SAP102 interacts with NMDA receptors and shaker-type potassium channels at synaptic membranes.
Other neuronal proteins with similar motifs (such as β1 adrenergic receptors, serotonin receptors, sodium channel subunits, and potassium channel subunits) may also bind to SAP102 via PDZ domains.
Neuronal nitric oxide synthase (nNOS) can associate with SAP102 through PDZ-PDZ interactions.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific PSD-95 Polyclonal Antibody
790,800원

Thermo Fisher Scientific
Thermo Fisher Scientific NHERF-1/EBP50 Polyclonal Antibody
923,800원

Thermo Fisher Scientific
Thermo Fisher Scientific SAP102 Polyclonal Antibody
923,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Caspr2 Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PSD-93 Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|