
Thermo Fisher Scientific RAB14 Polyclonal Antibody
상품 한눈에 보기
RAB14 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot에 적합하며, 인간 및 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124–153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747018 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Rab14 is localized to biosynthetic and endosomal compartments and is involved in the biosynthetic/recycling pathway between the Golgi and endosomal compartments.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific RAD51 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RALA Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RAB14 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RAB27A Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RAB13 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.