Thermo Fisher Scientific SFTPD Polyclonal Antibody
Thermo Fisher Scientific의 SFTPD Polyclonal Antibody는 인간 및 랫트 반응성을 가진 토끼 IgG 항체로, Western Blot, IHC, ICC, ELISA 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, SP-D 단백질 연구용으로 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Surfactant protein D (292–321aa RSAAENAALQQLVVAKNEAAFLSMTDSKTE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747104 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Surfactant protein D (SP-D) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins. Members of this group have multiple globular “head” regions linked by triple-helical, collagen-like strands. SP-D and SP-A, along with serum proteins such as mannan-binding protein, conglutinin, and collectin-43, bind to the C1q receptor found on various cells. SP-D and SP-A enhance oxygen radical production by alveolar macrophages.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-79989_SFTPD_P35247-1_Rabbit.svg, PA5-79989_SFTPD_P35247-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SHANK3 Polyclonal Antibody
599,200원
Thermo Fisher Scientific
Thermo Fisher Scientific Alpha Sarcoglycan Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SFTPD Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SFTPC Polyclonal Antibody
514,100원
Thermo Fisher Scientific
Thermo Fisher Scientific SFTPA1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|