Thermo Fisher Scientific SFTPD Polyclonal Antibody
Thermo Fisher Scientific의 SFTPD Polyclonal Antibody는 인간 및 랫트 반응성을 가진 토끼 IgG 항체로, Western Blot, IHC, ICC, ELISA 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, SP-D 단백질 연구용으로 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SFTPD Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Surfactant protein D (292–321aa RSAAENAALQQLVVAKNEAAFLSMTDSKTE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747104 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Surfactant protein D (SP-D) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins. Members of this group have multiple globular “head” regions linked by triple-helical, collagen-like strands. SP-D and SP-A, along with serum proteins such as mannan-binding protein, conglutinin, and collectin-43, bind to the C1q receptor found on various cells. SP-D and SP-A enhance oxygen radical production by alveolar macrophages.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-79989_SFTPD_P35247-1_Rabbit.svg, PA5-79989_SFTPD_P35247-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.