Thermo Fisher Scientific SHANK3 Polyclonal Antibody

Applications

Western Blot (WB)

• Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

Product Specific Information

• Synthetic peptide sequence: 1670–1710aa
  KFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKDDFV EL
• Add 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

SHANK3는 시냅스 후 밀도(postsynaptic density)의 주요 스캐폴드 단백질로, 다양한 단백질 및 복합체와 상호작용하여 수상돌기(spine)와 시냅스의 형성, 성숙 및 유지에 관여합니다. NMDA형 및 대사성 글루타메이트 수용체와 결합하여 수용체 복합체를 연결하고, Arp2/3 및 WAVE1 복합체를 통한 F-actin 클러스터 형성을 촉진합니다. 이를 통해 신경세포 성장콘 운동성, NMDA 수용체 신호전달, AMPA 및 mGluR 매개 시냅스 전달 및 가소성 조절에 기여합니다. 초기 시냅스 형성 단계에서 필요하며 IGF1에 의해 억제되어 시냅스 성숙을 촉진할 수 있습니다. (Uniprot)

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.