Thermo Fisher Scientific SHANK3 Polyclonal Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
PA579993 | - | Thermo Fisher Scientific PA579993 SHANK3 Polyclonal Antibody 100 ug pk | 재고문의 | pk | 0원 | - | 0원 |
다른 상품 둘러보기
Applications
Tested Dilution
Publications
Western Blot (WB)
0.1-0.5 µg/mL
Product Specifications
Host/Isotype
Rabbit / IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SHANK3.
Conjugate
Unconjugated Unconjugated Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2747108
Product Specific Information
The synthetic peptide sequence is 1670-1710aa, KFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKDDFV EL
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Target Information
SHANK3 is a major scaffold postsynaptic density protein which interacts with multiple proteins and complexes to orchestrate the dendritic spine and synapse formation, maturation and maintenance. It interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors via complexes with GKAP/PSD-95 and HOMER, respectively, and the actin-based cytoskeleton. SHANK3 plays a role in the structural and functional organization of the dendritic spine and synaptic junction through the interaction with Arp2/3 and WAVE1 complex as well as the promotion of the F-actin clusters. By way of this control of actin dynamics, SHANK3 participates in the regulation of developing neurons growth cone motility and the NMDA receptor-signaling. It also modulates GRIA1 exocytosis and GRM5/MGLUR5 expression and signaling to control the AMPA and metabotropic glutamate receptor-mediated synaptic transmission and plasticity. SHANK3 may be required at an early stage of synapse formation and be inhibited by IGF1 to promote synapse maturation. (Uniprot)
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|