
Atlas Antibodies Anti-ZBTB9 Antibody
상품 한눈에 보기
인간 ZBTB9 단백질을 인식하는 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 정제되었습니다. 인간에 대한 반응성이 검증되어 있으며 안정적인 PBS/glycerol 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZBTB9 Antibody
Target: Zinc finger and BTB domain containing 9 (ZBTB9)
Type: Polyclonal antibody against human ZBTB9
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human ZBTB9 protein.
Alternative Gene Names
- MGC23166
- ZNF919
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Zinc finger and BTB domain containing 9 |
| Target Gene | ZBTB9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PKEEISGSGTQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRF |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000026799 | 76% |
| Mouse | ENSMUSG00000079605 | 70% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZC2HC1C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB8OS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB8B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.