CacheBy
Atlas Antibodies Anti-ZBTB9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB9 Antibody

상품 한눈에 보기

인간 ZBTB9 단백질을 인식하는 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 정제되었습니다. 인간에 대한 반응성이 검증되어 있으며 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036767-100 Anti-ZBTB9 Antibody, zinc finger and BTB domain containing 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036767-25 Anti-ZBTB9 Antibody, zinc finger and BTB domain containing 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB9 Antibody

Anti-ZBTB9 Antibody

Target: Zinc finger and BTB domain containing 9 (ZBTB9)
Type: Polyclonal antibody against human ZBTB9
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human ZBTB9 protein.


Alternative Gene Names

  • MGC23166
  • ZNF919

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Zinc finger and BTB domain containing 9
Target Gene ZBTB9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PKEEISGSGTQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRF

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000026799 76%
Mouse ENSMUSG00000079605 70%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.