Atlas Antibodies Anti-ZBTB9 Antibody

상품 한눈에 보기

인간 ZBTB9 단백질을 인식하는 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 정제되었습니다. 인간에 대한 반응성이 검증되어 있으며 안정적인 PBS/glycerol 버퍼에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036767-100 Anti-ZBTB9 Antibody, zinc finger and BTB domain containing 9 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036767-25 Anti-ZBTB9 Antibody, zinc finger and BTB domain containing 9 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Zinc finger and BTB domain containing 9 (ZBTB9)
Type: Polyclonal antibody against human ZBTB9
Supplier: Atlas Antibodies

Polyclonal antibody targeting human ZBTB9 protein.

항목	내용
Target Protein	Zinc finger and BTB domain containing 9
Target Gene	ZBTB9
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PKEEISGSGTQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRF

Species	Gene ID	Identity
Rat	ENSRNOG00000026799	76%
Mouse	ENSMUSG00000079605	70%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Safety	Material Safety Data Sheet