CacheBy
Atlas Antibodies Anti-ZC2HC1C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZC2HC1C Antibody

상품 한눈에 보기

인간 ZC2HC1C 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 PBS 버퍼에 나트륨 아지드 보존제가 포함됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050928-100 Anti-ZC2HC1C Antibody, zinc finger, C2HC-type containing 1C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050928-25 Anti-ZC2HC1C Antibody, zinc finger, C2HC-type containing 1C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZC2HC1C Antibody

Anti-ZC2HC1C Antibody

Target: zinc finger, C2HC-type containing 1C
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ZC2HC1C.


Alternative Gene Names

  • C14orf140
  • FAM164C

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger, C2HC-type containing 1C
Target Gene ZC2HC1C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000027115 (53%), Mouse ENSMUSG00000045064 (53%)

Antigen Sequence:
ENENGELQKIILPRSRVKGNKSNTMYKPIFSPEFEFEEEFSRDRREDETWGRSQQNSVPFQFSDYRIQRLKRERLVASNNKIRDP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.