CacheBy
Atlas Antibodies Anti-ZBTB8B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB8B Antibody

상품 한눈에 보기

인간 ZBTB8B 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit에서 생산된 IgG 형식으로, IHC 등 다양한 연구 응용에 적합합니다. 높은 종간 특이성과 정제된 품질을 제공합니다. PBS/glycerol 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA055553-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055553-100 Anti-ZBTB8B Antibody, zinc finger and BTB domain containing 8B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055553-25 Anti-ZBTB8B Antibody, zinc finger and BTB domain containing 8B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB8B Antibody

Anti-ZBTB8B Antibody

Target: Zinc finger and BTB domain containing 8B
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human ZBTB8B


Alternative Gene Names

DKFZp547H154, RP1-27O5.1, ZNF916B

Open Datasheet


Target Information

항목 내용
Target Protein Zinc finger and BTB domain containing 8B
Target Gene ZBTB8B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000026898 (88%), Mouse ENSMUSG00000048485 (84%)

Sequence

SNRPIICKGCRRTFTSHLSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDNDWPIYVESEI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.