
Atlas Antibodies Anti-ZBTB20 Antibody
인간 ZBTB20 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응하며, 마우스 및 랫과 높은 서열 유사성을 가집니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZBTB20 Antibody
Zinc finger and BTB domain containing 20
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ZBTB20
Alternative Gene Names
DKFZp566F123, DPZF, ODA-8S, ZNF288
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Zinc finger and BTB domain containing 20 |
| Target Gene | ZBTB20 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
Antigen Sequence
SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQ
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000022708): 91%
- Rat (ENSRNOG00000056716): 90%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZBTB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|