CacheBy
Atlas Antibodies Anti-ZBTB18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB18 Antibody

상품 한눈에 보기

인간 ZBTB18 단백질을 인식하는 폴리클로날 항체로, 다양한 면역학적 응용에 적합. 토끼에서 생산된 IgG 형 항체이며, 높은 종간 보존성. PrEST 항원으로 친화 정제되어 높은 특이성과 순도를 제공. 인체 및 동물 모델 연구에 활용 가능.

카탈로그번호
HPA024656-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024656-100 Anti-ZBTB18 Antibody, zinc finger and BTB domain containing 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024656-25 Anti-ZBTB18 Antibody, zinc finger and BTB domain containing 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB18 Antibody

Anti-ZBTB18 Antibody

Target: Zinc finger and BTB domain containing 18 (ZBTB18)
Supplier: Atlas Antibodies


면역세포화학(ICC)


Product Description

Polyclonal antibody against Human ZBTB18.


Alternative Gene Names

C2H2-171, RP58, TAZ-1, ZNF238

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Zinc finger and BTB domain containing 18
Target Gene ZBTB18
Verified Species Reactivity Human
Interspecies Identity Mouse (99%), Rat (98%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SYLHMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.