CacheBy
Atlas Antibodies Anti-ZBTB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB2 Antibody

상품 한눈에 보기

인간 ZBTB2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB 실험에 적합하며, 재조합 발현 검증을 완료했습니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA023487-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023487-100 Anti-ZBTB2 Antibody, zinc finger and BTB domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023487-25 Anti-ZBTB2 Antibody, zinc finger and BTB domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB2 Antibody

Anti-ZBTB2 Antibody

Target: zinc finger and BTB domain containing 2 (ZBTB2)
Type: Polyclonal Antibody against Human ZBTB2


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation:
Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody raised in rabbit against Human ZBTB2 protein.


Alternative Gene Names

bA351K16.2, KIAA1483, ZNF437

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger and BTB domain containing 2
Target Gene ZBTB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence IFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFSHPDQVFPLASSLYGIQIADHQLR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019544 (97%), Mouse ENSMUSG00000075327 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.