CacheBy
Atlas Antibodies Anti-HTR2B Antibody
원본

Atlas Antibodies Anti-HTR2B Antibody

상품 한눈에 보기

인간 HTR2B 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터와의 orthogonal validation을 통해 검증되었습니다. Rabbit IgG 포맷으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063658-100 Anti-HTR2B Antibody, 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063658-25 Anti-HTR2B Antibody, 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HTR2B Antibody

Anti-HTR2B Antibody

5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled

  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human HTR2B

Alternative Gene Names

  • 5-HT(2B)
  • 5-HT2B

Open Datasheet

Target Information

항목 내용
Target Protein 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Target Gene HTR2B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026228 (77%), Rat ENSRNOG00000017625 (77%)

Antigen Sequence

TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.