CacheBy
Atlas Antibodies Anti-HTR2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HTR2B Antibody

상품 한눈에 보기

인간 HTR2B 단백질을 표적으로 하는 토끼 유래 폴리클로날 IgG 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반의 정교한 단백질 발현 검증 제공. 프레스티지 항원으로 친화 정제되어 높은 특이성과 재현성을 보장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012867-100 Anti-HTR2B Antibody, 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012867-25 Anti-HTR2B Antibody, 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HTR2B Antibody

Anti-HTR2B Antibody

Target: 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues

Product Description

Polyclonal antibody against human HTR2B.

Alternative Gene Names

  • 5-HT(2B)
  • 5-HT2B

Target Information

항목 내용
Target Protein 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Target Gene HTR2B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026228 (77%), Rat ENSRNOG00000017625 (77%)

Clonality and Host

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

구성 성분 농도 및 조건
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)
참고 Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL

Additional Resources

Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.