
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HTR7 Antibody
상품 한눈에 보기
Human HTR7 단백질을 인식하는 토끼 폴리클로날 항체로, 5-HT7 수용체 연구에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 인간 시료에 검증되었습니다. 다양한 응용 분야에서 최적 조건은 사용자가 결정합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA073617-100 Anti-HTR7 Antibody, 5-hydroxytryptamine receptor 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073617-25 Anti-HTR7 Antibody, 5-hydroxytryptamine receptor 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HTR7 Antibody
Anti-HTR7 Antibody
Target Information
- Target Protein: 5-hydroxytryptamine receptor 7
- Target Gene: HTR7
- Alternative Gene Names: 5-HT7
Product Description
Polyclonal antibody against human HTR7, designed for detection of 5-hydroxytryptamine receptor 7.
Recommended Applications
- Immunohistochemistry (IHC)
- Other user-validated applications
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000024798 | 61% |
| Rat | ENSRNOG00000055705 | 59% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



