CacheBy
Atlas Antibodies Anti-HTR7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HTR7 Antibody

상품 한눈에 보기

Human HTR7 단백질을 인식하는 토끼 폴리클로날 항체로, 5-HT7 수용체 연구에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 인간 시료에 검증되었습니다. 다양한 응용 분야에서 최적 조건은 사용자가 결정합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073617-100 Anti-HTR7 Antibody, 5-hydroxytryptamine receptor 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073617-25 Anti-HTR7 Antibody, 5-hydroxytryptamine receptor 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HTR7 Antibody

Anti-HTR7 Antibody

Target Information

  • Target Protein: 5-hydroxytryptamine receptor 7
  • Target Gene: HTR7
  • Alternative Gene Names: 5-HT7

Product Description

Polyclonal antibody against human HTR7, designed for detection of 5-hydroxytryptamine receptor 7.

  • Immunohistochemistry (IHC)
  • Other user-validated applications

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000024798 61%
Rat ENSRNOG00000055705 59%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.