Atlas Antibodies Anti-HTR7 Antibody
상품 한눈에 보기
Human HTR7 단백질을 인식하는 토끼 폴리클로날 항체로, 5-HT7 수용체 연구에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 인간 시료에 검증되었습니다. 다양한 응용 분야에서 최적 조건은 사용자가 결정합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HTR7 Antibody
Target Information
- Target Protein: 5-hydroxytryptamine receptor 7
- Target Gene: HTR7
- Alternative Gene Names: 5-HT7
Product Description
Polyclonal antibody against human HTR7, designed for detection of 5-hydroxytryptamine receptor 7.
Recommended Applications
- Immunohistochemistry (IHC)
- Other user-validated applications
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000024798 | 61% |
| Rat | ENSRNOG00000055705 | 59% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.