
Atlas Antibodies Anti-HOMEZ Antibody
상품 한눈에 보기
Human HOMEZ 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG로 PrEST 항원 기반 친화 정제. HOMEZ 유전자 및 관련 단백질 발현 연구에 검증된 시약.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HOMEZ Antibody
Human HOMEZ 단백질을 인식하는 폴리클로날 항체로, homeobox 및 leucine zipper encoding 단백질을 대상으로 합니다.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent antibody validation
- Immunocytochemistry (ICC)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human HOMEZ
Alternative Gene Names
- KIAA1443
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | homeobox and leucine zipper encoding |
| Target Gene | HOMEZ |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000014887 (79%), Mouse ENSMUSG00000057156 (71%) |
Antigen Sequence:
SSSFQVLANGATAASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHNSVPGRVGPTEYLSPDMQRQRKTKRK
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HOOK3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HOMEZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HOMEZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HOOK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HOOK1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.