Atlas Antibodies Anti-HOMEZ Antibody

상품 한눈에 보기

Human HOMEZ 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG로 PrEST 항원 기반 친화 정제. HOMEZ 유전자 및 관련 단백질 발현 연구에 검증된 시약.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036316-100 Anti-HOMEZ Antibody, homeobox and leucine zipper encoding 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036316-25 Anti-HOMEZ Antibody, homeobox and leucine zipper encoding 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Human HOMEZ 단백질을 인식하는 폴리클로날 항체로, homeobox 및 leucine zipper encoding 단백질을 대상으로 합니다.

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human HOMEZ

항목	내용
Target Protein	homeobox and leucine zipper encoding
Target Gene	HOMEZ
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000014887 (79%), Mouse ENSMUSG00000057156 (71%)

Antigen Sequence:
SSSFQVLANGATAASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHNSVPGRVGPTEYLSPDMQRQRKTKRK

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand