Atlas Antibodies Anti-HOMEZ Antibody

상품 한눈에 보기

인간 HOMEZ 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼에서 유래하며 PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 보존성과 신뢰성 있는 단백질 발현 검증 데이터를 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036317-100 Anti-HOMEZ Antibody, homeobox and leucine zipper encoding 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036317-25 Anti-HOMEZ Antibody, homeobox and leucine zipper encoding 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

homeobox and leucine zipper encoding

IHC (Immunohistochemistry)
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human HOMEZ

항목	내용
Target Protein	homeobox and leucine zipper encoding
Target Gene	HOMEZ
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SSSFQVLANGATAASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHNSVPGRVGPTEYLSPDMQRQRKTKRK