CacheBy
Atlas Antibodies Anti-HOOK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HOOK1 Antibody

상품 한눈에 보기

Human HOOK1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, 고순도 Affinity purification 방식으로 제조되었습니다. Human, Mouse, Rat 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018820-100 Anti-HOOK1 Antibody, hook microtubule-tethering protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018820-25 Anti-HOOK1 Antibody, hook microtubule-tethering protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HOOK1 Antibody

Anti-HOOK1 Antibody

Target: hook microtubule-tethering protein 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human HOOK1


Alternative Gene Names

  • HK1

Open Datasheet


Target Information

항목 내용
Target Protein hook microtubule-tethering protein 1
Target Gene HOOK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000028572 (94%), Rat ENSRNOG00000026226 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

KRALEELQEALAEKEELRQRCEELDMQVTTLQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHC

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.