원본
Thermo Fisher Scientific CGA Polyclonal Antibody
상품 한눈에 보기
CGA 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot 및 ELISA에 적합. 인간 시료 반응성, 고순도 친화 크로마토그래피 정제. PBS/glycerol 완충액에 보관되며 -20°C에서 안정적. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 03:25
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA588517 CGA Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
618,800원VAT 포함 680,680원
Thermo Fisher Scientific · Thermo Fisher Scientific CGA Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:500–1:2,000 | View 1 publication |
| ELISA | 1 µg/mL | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25–116 of human CGA (NP_0007261) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.23 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2804969 |
Product Specific Information
- Immunogen sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
- Positive Samples: MCF7
Target Information
The four human glycoprotein hormones—chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH)—are dimers consisting of alpha and beta subunits associated noncovalently. The alpha subunits of these hormones are identical, while the beta chains are unique and confer biological specificity. The encoded protein is the alpha subunit, belonging to the glycoprotein hormones alpha chain family.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific IBA1 Polyclonal Antibody618,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ALAD Polyclonal Antibody618,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Acid Phosphatase 1 Polyclonal Antibody618,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MCT2 Polyclonal Antibody618,800원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.