Thermo Fisher Scientific CGA Polyclonal Antibody
CGA 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot 및 ELISA에 적합. 인간 시료 반응성, 고순도 친화 크로마토그래피 정제. PBS/glycerol 완충액에 보관되며 -20°C에서 안정적. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:500–1:2,000 | View 1 publication |
| ELISA | 1 µg/mL | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25–116 of human CGA (NP_0007261) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.23 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2804969 |
Product Specific Information
- Immunogen sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
- Positive Samples: MCF7
Target Information
The four human glycoprotein hormones—chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH)—are dimers consisting of alpha and beta subunits associated noncovalently. The alpha subunits of these hormones are identical, while the beta chains are unique and confer biological specificity. The encoded protein is the alpha subunit, belonging to the glycoprotein hormones alpha chain family.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IBA1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ALAD Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific CGA Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Acid Phosphatase 1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific MCT2 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|