Thermo Fisher Scientific TCP1 Polyclonal Antibody
TCP1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC/IF에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로 세포 내 단백질 접힘 연구에 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific TCP1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 (515–551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | –20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747215 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The T Complex Polypeptide 1 (TCP-1) is an approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone complex involved in the folding of actin and tubulin.
Chaperonin family proteins recognize and stabilize polypeptide intermediates during folding, assembly, and disassembly. They share characteristics with Heat Shock Protein 70 (HSP70), including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes mitochondrial HSP60, E. coli GroEL, plastid Rubisco-subunit binding protein, and archaebacterial TF55. The TCP-1 sequence shows approximately 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.