Thermo Fisher Scientific TCP1 Polyclonal Antibody
TCP1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC/IF에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로 세포 내 단백질 접힘 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 (515–551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | –20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747215 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The T Complex Polypeptide 1 (TCP-1) is an approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone complex involved in the folding of actin and tubulin.
Chaperonin family proteins recognize and stabilize polypeptide intermediates during folding, assembly, and disassembly. They share characteristics with Heat Shock Protein 70 (HSP70), including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes mitochondrial HSP60, E. coli GroEL, plastid Rubisco-subunit binding protein, and archaebacterial TF55. The TCP-1 sequence shows approximately 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Synapsin II Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TEC Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TCP1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TCF7L1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TAP1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|