Thermo Fisher Scientific Aquaporin 2 Polyclonal Antibody
Aquaporin 2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, IHC, Flow Cytometry에 적합합니다. 인간, 마우스, 랫트 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241–271aa: EPDTDWEEREVRRRQSVELHSPQSLPRGTKA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745925 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Aquaporin 2 (AQP2) is a hormonally regulated water channel located in the renal collecting duct. Mutations in the AQP2 gene cause hereditary nephrogenic diabetes insipidus in humans. A vasopressin-induced cAMP increase results in phosphorylation of AQP2 at serine-256 and its translocation from intracellular vesicles to the apical membrane of principal cells. Recently, serine-261 has been identified as a novel phosphorylation site on AQP2, and levels of phosphorylated S261 have been shown to decrease with vasopressin treatment, suggesting its involvement in vasopressin-dependent AQP2 trafficking.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific APRT Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ApoC3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|