Atlas Antibodies Anti-HGFAC Antibody
상품 한눈에 보기
인간 HGFAC 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간에 높은 반응성을 보이며 Rat, Mouse에도 교차 반응 가능. 안정적 PBS/glycerol buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HGFAC Antibody
HGF activator
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human HGFAC
Alternative Gene Names
HGFA, HGFAP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | HGF activator |
| Target Gene | HGFAC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DERPWCYVVKDSALSWEYCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIG |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000009572 | 83% |
| Mouse | ENSMUSG00000029102 | 80% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.