CacheBy
Atlas Antibodies Anti-HGD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HGD Antibody

상품 한눈에 보기

인간 HGD 단백질을 인식하는 토끼 다클론 항체. IHC 및 WB에서 검증된 신뢰성 높은 시약. Orthogonal 및 Independent validation 수행. PrEST 항원을 이용한 친화 정제. 인간, 쥐, 랫드에 높은 서열 유사성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052359-100 Anti-HGD Antibody, homogentisate 1,2-dioxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052359-25 Anti-HGD Antibody, homogentisate 1,2-dioxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HGD Antibody

Anti-HGD Antibody

Target: homogentisate 1,2-dioxygenase (HGD)
Supplier: Atlas Antibodies


  • IHC Orthogonal validation: 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 발현을 교차 검증함.
  • WB Independent validation: 서로 다른 에피토프를 인식하는 독립 항체 간의 단백질 발현 비교를 통해 검증함.

Product Description

Polyclonal antibody against human HGD.


Alternative Gene Names

AKU, HGO

Open Datasheet


Specifications

항목 내용
Target Protein homogentisate 1,2-dioxygenase
Target Gene HGD
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000002701 (94%), Mouse ENSMUSG00000022821 (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
IHC Orthogonal Tooltip
WB Independent Validation
WB Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.