Atlas Antibodies Anti-HGD Antibody

상품 한눈에 보기

Human HGD 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. RNA-seq 및 독립 항체 비교를 통한 정교한 검증 수행. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047374-100 Anti-HGD Antibody, homogentisate 1,2-dioxygenase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047374-25 Anti-HGD Antibody, homogentisate 1,2-dioxygenase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: homogentisate 1,2-dioxygenase
Type: Polyclonal Antibody against Human HGD

IHC (Orthogonal Validation):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Independent Validation):
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody raised in rabbit against human HGD (homogentisate 1,2-dioxygenase).

AKU, HGO

항목	내용
Target Protein	homogentisate 1,2-dioxygenase
Target Gene	HGD
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	QVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPP
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000002701 (94%), Mouse ENSMUSG00000022821 (93%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.