CacheBy
Atlas Antibodies Anti-GTF2H1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GTF2H1 Antibody

상품 한눈에 보기

인간 GTF2H1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원 기반 친화 정제 방식 사용. 사람에 대한 반응성 검증 완료. RNA-seq 데이터와 비교한 Orthogonal Validation 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046660-100 Anti-GTF2H1 Antibody, general transcription factor IIH, polypeptide 1, 62kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046660-25 Anti-GTF2H1 Antibody, general transcription factor IIH, polypeptide 1, 62kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GTF2H1 Antibody

Anti-GTF2H1 Antibody

Target: general transcription factor IIH, polypeptide 1, 62kDa
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation using RNA-seq comparison)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human GTF2H1


Alternative Gene Names

BTF2, P62, TFIIH

Open Datasheet


Specifications

항목 내용
Target Protein general transcription factor IIH, polypeptide 1, 62kDa
Target Gene GTF2H1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000006599 (98%), Rat ENSRNOG00000012360 (98%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

PEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYN


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.