
Atlas Antibodies Anti-GTF2H1 Antibody
인간 GTF2H1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원 기반 친화 정제 방식 사용. 사람에 대한 반응성 검증 완료. RNA-seq 데이터와 비교한 Orthogonal Validation 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GTF2H1 Antibody
Target: general transcription factor IIH, polypeptide 1, 62kDa
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq comparison)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GTF2H1
Alternative Gene Names
BTF2, P62, TFIIH
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | general transcription factor IIH, polypeptide 1, 62kDa |
| Target Gene | GTF2H1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000006599 (98%), Rat ENSRNOG00000012360 (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
PEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYN
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GTF2F1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2H2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2H1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2F1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2E2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|