
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GTF2H2 Antibody
상품 한눈에 보기
Human GTF2H2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며, 고순도의 IgG 형태입니다. 사람에 대해 검증되었으며, 생물학적 연구용으로 안정적인 결과를 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047001-100 Anti-GTF2H2 Antibody, general transcription factor IIH, polypeptide 2, 44kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047001-25 Anti-GTF2H2 Antibody, general transcription factor IIH, polypeptide 2, 44kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GTF2H2 Antibody
Anti-GTF2H2 Antibody
Target: general transcription factor IIH, polypeptide 2, 44kDa
Type: Polyclonal Antibody against Human GTF2H2
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody specifically targets the human GTF2H2 protein, also known as general transcription factor IIH, polypeptide 2 (44 kDa).
Alternative Gene Names
BTF2, BTF2P44, p44, T-BTF2P44, TFIIH
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | general transcription factor IIH, polypeptide 2, 44 kDa |
| Target Gene | GTF2H2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (97%), Rat (96%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



