CacheBy
Atlas Antibodies Anti-GTF2H2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GTF2H2 Antibody

상품 한눈에 보기

Human GTF2H2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며, 고순도의 IgG 형태입니다. 사람에 대해 검증되었으며, 생물학적 연구용으로 안정적인 결과를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047001-100 Anti-GTF2H2 Antibody, general transcription factor IIH, polypeptide 2, 44kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047001-25 Anti-GTF2H2 Antibody, general transcription factor IIH, polypeptide 2, 44kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GTF2H2 Antibody

Anti-GTF2H2 Antibody

Target: general transcription factor IIH, polypeptide 2, 44kDa
Type: Polyclonal Antibody against Human GTF2H2


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody specifically targets the human GTF2H2 protein, also known as general transcription factor IIH, polypeptide 2 (44 kDa).


Alternative Gene Names

BTF2, BTF2P44, p44, T-BTF2P44, TFIIH

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein general transcription factor IIH, polypeptide 2, 44 kDa
Target Gene GTF2H2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Verified Species Reactivity Human
Interspecies Homology Mouse (97%), Rat (96%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.