
Atlas Antibodies Anti-GTF2F1 Antibody
상품 한눈에 보기
인간 GTF2F1을 인식하는 폴리클로날 항체로, IHC, WB(재조합 발현), ICC 등 다양한 응용에 적합. 토끼 유래 IgG 형식이며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인체 반응성이 검증된 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GTF2F1 Antibody
Target: General transcription factor IIF, polypeptide 1, 74 kDa
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression)
- Immunocytochemistry (ICC)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human GTF2F1
Alternative Gene Names
BTF4, RAP74, TF2F1, TFIIF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | General transcription factor IIF, polypeptide 1, 74 kDa |
| Target Gene | GTF2F1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000047134 (98%), Mouse ENSMUSG00000002658 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GTF2H2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2H1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2F1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2E2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTF2E2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.