Atlas Antibodies Anti-GSTO1 Antibody

상품 한눈에 보기

Human GSTO1 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037604-100 Anti-GSTO1 Antibody, glutathione S-transferase omega 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037604-25 Anti-GSTO1 Antibody, glutathione S-transferase omega 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GSTO1 Antibody

Anti-GSTO1 Antibody

Target: Glutathione S-transferase omega 1 (GSTO1)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal antibody against human GSTO1.

Alternative Gene Names

GSTTLp28, P28

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)

Antigen Sequence:

WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

Verified Species Reactivity

Human

Interspecies Identity

Species	Gene ID	Identity (%)
Rat	ENSRNOG00000028746	66%
Mouse	ENSMUSG00000025068	63%

Antibody Characteristics

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand