
Atlas Antibodies Anti-GSTO1 Antibody
상품 한눈에 보기
Human GSTO1 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GSTO1 Antibody
Target: Glutathione S-transferase omega 1 (GSTO1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody against human GSTO1.
Alternative Gene Names
GSTTLp28, P28
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Verified Species Reactivity
Human
Interspecies Identity
| Species | Gene ID | Identity (%) |
|---|---|---|
| Rat | ENSRNOG00000028746 | 66% |
| Mouse | ENSMUSG00000025068 | 63% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GTF2A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GSTO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GSTZ1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GSTP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.