CacheBy
Atlas Antibodies Anti-GTDC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GTDC1 Antibody

상품 한눈에 보기

Human GTDC1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 응용에 적합. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성 제공. GTDC1 및 관련 ortholog 분석에 활용 가능.

카탈로그번호
HPA036694-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036694-100 Anti-GTDC1 Antibody, glycosyltransferase-like domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036694-25 Anti-GTDC1 Antibody, glycosyltransferase-like domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GTDC1 Antibody

Anti-GTDC1 Antibody

Target: Glycosyltransferase-like domain containing 1 (GTDC1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human GTDC1.


Alternative Gene Names

  • FLJ11753
  • Hmat-Xa

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Glycosyltransferase-like domain containing 1
Target Gene GTDC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HWGYLPSKDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIAPFSWAAL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000031038 93%
Mouse ENSMUSG00000036890 93%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.