CacheBy
Atlas Antibodies Anti-GSTP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSTP1 Antibody

상품 한눈에 보기

Human GSTP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019779-100 Anti-GSTP1 Antibody, glutathione S-transferase pi 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019779-25 Anti-GSTP1 Antibody, glutathione S-transferase pi 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSTP1 Antibody

Anti-GSTP1 Antibody

Target Protein: glutathione S-transferase pi 1 (GSTP1)


  • IHC (Independent antibody validation)
  • WB (Western Blot)

Validation: Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human GSTP1.


Alternative Gene Names

FAEES3, GST3, GSTP

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein glutathione S-transferase pi 1
Target Gene GSTP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000097830 (89%), Rat ENSRNOG00000018237 (83%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.