
Atlas Antibodies Anti-GSS Antibody
상품 한눈에 보기
Human GSS(glutathione synthetase)를 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 높은 신뢰성 확보. Affinity purification 방식으로 정제되어 높은 특이도 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GSS Antibody
Target: Glutathione synthetase (GSS)
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 IHC 결과를 교차 검증
- WB Independent Validation: 서로 다른 epitope을 인식하는 독립 항체 간 단백질 발현 비교로 검증
- ICC: 세포 수준에서 단백질 발현 분석에 활용 가능
Product Description
Polyclonal antibody against human GSS (glutathione synthetase).
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Glutathione synthetase |
| Target Gene | GSS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027610 (93%) Rat ENSRNOG00000018964 (91%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
