CacheBy
Atlas Antibodies Anti-GSS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSS Antibody

상품 한눈에 보기

Human GSS(glutathione synthetase)를 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 높은 신뢰성 확보. Affinity purification 방식으로 정제되어 높은 특이도 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054508-100 Anti-GSS Antibody, glutathione synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054508-25 Anti-GSS Antibody, glutathione synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSS Antibody

Anti-GSS Antibody

Target: Glutathione synthetase (GSS)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 IHC 결과를 교차 검증
  • WB Independent Validation: 서로 다른 epitope을 인식하는 독립 항체 간 단백질 발현 비교로 검증
  • ICC: 세포 수준에서 단백질 발현 분석에 활용 가능

Product Description

Polyclonal antibody against human GSS (glutathione synthetase).
Open Datasheet (PDF)


Specifications

항목 내용
Target Protein Glutathione synthetase
Target Gene GSS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027610 (93%)
Rat ENSRNOG00000018964 (91%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method Affinity purified using PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.